Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-serine O-palmitoleoyltransferase porcupine
LigandBDBM50133868
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1526517
IC50 5.0±n/a nM
Citation Ho, SYKeller, TH The use of porcupine inhibitors to target Wnt-driven cancers. Bioorg Med Chem Lett25:5472-6 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Protein-serine O-palmitoleoyltransferase porcupine
Name:Protein-serine O-palmitoleoyltransferase porcupine
Synonyms:2.3.1.- | MG61 | PORC | PORCN | PPN | Protein MG61 | Protein-serine O-palmitoleoyltransferase porcupine
Type:PROTEIN
Mol. Mass.:52337.13
Organism:Homo sapiens
Description:ChEMBL_103574
Residue:461
Sequence:
MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVAGG
FFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLMGEMHMVDTVTW
HKMRGAQMIVAMKAVSLGFDLDRGEVGTVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAV
QGRPLSCRWLQKVARSLALALLCLVLSTCVGPYLFPYFIPLNGDRLLRNKKRKARGTMVR
WLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVE
VVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLSLAFITYV
EHVLRKRLARILSACVLSKRCPPDCSHQHRLGLGVRALNLLFGALAIFHLAYLGSLFDVD
VDDTTEEQGYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133868
NameBDBM50133868
Synonyms:CHEMBL3633804
TypeSmall organic molecule
Emp. Form.C22H21N7O3
Mol. Mass.431.4472
SMILESCn1c2nc3CC[C@@H](CC(=O)Nc4ccc(nn4)-c4ccccc4)n3c2c(=O)n(C)c1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a