Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-3/beta-4 subunit
LigandBDBM50142624
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1552364
Ki 194±n/a nM
Citation Matera, CQuadri, MSciaccaluga, MPom, DYFasoli, FDe Amici, MFucile, SGotti, CDallanoce, CGrazioso, G Modification of the anabaseine pyridine nucleus allows achieving binding and functional selectivity for thea34 nicotinic acetylcholine receptor subtype. Eur J Med Chem108:392-405 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-3/beta-4 subunit
Name:Neuronal acetylcholine receptor protein alpha-3/beta-4 subunit
Synonyms:Neuronal acetylcholine receptor; alpha3/beta4
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 143409
Components:This complex has 2 components.
Component 1
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Synonyms:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Type:Enzyme Catalytic Domain
Mol. Mass.:56388.51
Organism:HUMAN
Description:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5 0 HUMAN::P30926
Residue:498
Sequence:
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Synonyms:Neuronal acetylcholine receptor protein alpha-3 subunit | Neuronal acetylcholine receptor subunit alpha-3
Type:PROTEIN
Mol. Mass.:57479.03
Organism:Homo sapiens
Description:ChEMBL_143235
Residue:505
Sequence:
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50142624
NameBDBM50142624
Synonyms:CHEMBL3759403
TypeSmall organic molecule
Emp. Form.C11H13N
Mol. Mass.159.2276
SMILESC1CCC(=NC1)c1ccccc1 |c:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a