Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA2
LigandBDBM50142614
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1552627
Ki 2260±n/a nM
Citation Szymanska, EFrydenvang, KPickering, DSKrintel, CNielsen, BKooshki, AZachariassen, LGOlsen, LKastrup, JSJohansen, TN Studies on Aryl-Substituted Phenylalanines: Synthesis, Activity, and Different Binding Modes at AMPA Receptors. J Med Chem59:448-61 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIA2
Name:Glutamate receptor AMPA 1/2
Synonyms:AMPA-selective glutamate receptor 2 | GluR-2 | GluR-B | GluR-K2 | Glutamate AMPA 2 | Glutamate receptor 2 | Glutamate receptor ionotropic AMPA | Glutamate receptor ionotropic, AMPA 2
Type:Enzyme Catalytic Domain
Mol. Mass.:98825.96
Organism:Homo sapiens (Human)
Description:Glutamate AMPA 2 GRIA2 HUMAN::P42262
Residue:883
Sequence:
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50142614
NameBDBM50142614
Synonyms:CHEMBL3758336
TypeSmall organic molecule
Emp. Form.C14H12Cl2N2O3
Mol. Mass.327.163
SMILESN[C@@H](Cc1cc(Cl)c(Cl)c(c1)-c1cncc(O)c1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a