Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholine kinase alpha
LigandBDBM50145918
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1554155
Kd 132000±n/a nM
Citation Zech, SGKohlmann, AZhou, TLi, FSquillace, RMParillon, LEGreenfield, MTMiller, DPQi, JThomas, RMWang, YXu, YMiret, JJShakespeare, WCZhu, XDalgarno, DC Novel Small Molecule Inhibitors of Choline Kinase Identified by Fragment-Based Drug Discovery. J Med Chem59:671-86 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Choline kinase alpha
Name:Choline kinase alpha
Synonyms:Choline kinase alpha
Type:PROTEIN
Mol. Mass.:52248.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1290064
Residue:457
Sequence:
MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPP
PPLPLPLPLPQPPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGL
SNMLFQCSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLE
SVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKM
PFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPV
VFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYP
FFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW
GLWSIVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50145918
NameBDBM50145918
Synonyms:CHEMBL3763993
TypeSmall organic molecule
Emp. Form.C14H23N3
Mol. Mass.233.3525
SMILESCN1CCCN(Cc2ccc(CN)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a