Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCereblon isoform 4
LigandBDBM50070114
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1555515
IC50 7800±n/a nM
Citation Boichenko, IDeiss, SBär, KHartmann, MDHernandez Alvarez, B A FRET-Based Assay for the Identification and Characterization of Cereblon Ligands. J Med Chem59:770-4 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cereblon isoform 4
Name:Cereblon isoform 4
Synonyms:Cereblon isoform 4
Type:PROTEIN
Mol. Mass.:13620.40
Organism:Magnetospirillum gryphiswaldense
Description:ChEMBL_116733
Residue:124
Sequence:
MPLDAGGQNSTQMVLAPGASIFRCRQCGQTISRRDWLLPMGGDHEHVVFNPAGMIFRVWC
FSLAQGLRLIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAE
GPAD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070114
NameBDBM50070114
Synonyms:(+/-)-thalidomide | 2-(2,6-Dioxo-piperidin-3-yl)-isoindole-1,3-dione | 2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione | CHEMBL468 | K-17 | THALIDOMIDE | Thalomid | [(R,S)-2-(2,6-dioxo-3-piperidinyl)-1H-isoindole-1,3(2H)-dione
TypeSmall organic molecule
Emp. Form.C13H10N2O4
Mol. Mass.258.2295
SMILESO=C1N(C2CCC(=O)NC2=O)C(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a