Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 3
LigandBDBM50147620
Substrate/Competitorn/a
Meas. Tech.ChEBML_1558042
IC50<50119±n/a nM
Citation Theodoulou, NHBamborough, PBannister, AJBecher, IBit, RAChe, KHChung, CWDittmann, ADrewes, GDrewry, DHGordon, LGrandi, PLeveridge, MLindon, MMichon, AMMolnar, JRobson, SCTomkinson, NCKouzarides, TPrinjha, RKHumphreys, PG Discovery of I-BRD9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition. J Med Chem59:1425-39 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 3
Name:Bromodomain-containing protein 3
Synonyms:Bromodomain-containing protein 3 | Bromodomain-containing protein 3 (BRD3) | RING3-like protein
Type:Protein
Mol. Mass.:79571.81
Organism:Homo sapiens (Human)
Description:Q15059
Residue:726
Sequence:
MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD
DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPA
TPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKK
GVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST
VKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL
SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKA
NSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEEL
AQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSS
DSSDSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50147620
NameBDBM50147620
Synonyms:CHEMBL3769507
TypeSmall organic molecule
Emp. Form.C22H22F3N3O3S2
Mol. Mass.497.554
SMILESCCn1cc(-c2cccc(c2)C(F)(F)F)c2sc(cc2c1=O)C(=N)NC1CCS(=O)(=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a