Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 9
LigandBDBM50148458
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1557801
IC50 126±n/a nM
Citation Theodoulou, NHBamborough, PBannister, AJBecher, IBit, RAChe, KHChung, CWDittmann, ADrewes, GDrewry, DHGordon, LGrandi, PLeveridge, MLindon, MMichon, AMMolnar, JRobson, SCTomkinson, NCKouzarides, TPrinjha, RKHumphreys, PG Discovery of I-BRD9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition. J Med Chem59:1425-39 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 9
Name:Bromodomain-containing protein 9
Synonyms:BRD9 | Bromodomain-containing protein 9 | Rhabdomyosarcoma antigen MU-RMS-40.8
Type:PROTEIN
Mol. Mass.:66994.30
Organism:Homo sapiens (Human)
Description:ChEMBL_108000
Residue:597
Sequence:
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148458
NameBDBM50148458
Synonyms:CHEMBL3770039
TypeSmall organic molecule
Emp. Form.C18H18N2O4S
Mol. Mass.358.412
SMILESCNC(=O)c1cc2c(s1)c(cn(C)c2=O)-c1ccc(OC)c(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a