Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalmodulin-domain protein kinase 1 (CDPK1)
LigandBDBM50148652
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1557115
IC50 5.5±n/a nM
Citation Huang, WOjo, KKZhang, ZRivas, KVidadala, RSScheele, SDeRocher, AEChoi, RHulverson, MABarrett, LKBruzual, ISiddaramaiah, LKKerchner, KMKurnick, MDFreiberg, GMKempf, DHol, WGMerritt, EANeckermann, Gde Hostos, ELIsoherranen, NMaly, DJParsons, MDoggett, JSVan Voorhis, WCFan, E SAR Studies of 5-Aminopyrazole-4-carboxamide Analogues as Potent and Selective Inhibitors of Toxoplasma gondii CDPK1. ACS Med Chem Lett6:1184-1189 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calmodulin-domain protein kinase 1 (CDPK1)
Name:Calmodulin-domain protein kinase 1 (CDPK1)
Synonyms:Calmodulin-domain protein kinase 1 | Calmodulin-domain protein kinase, putative
Type:Enzyme Catalytic Domain
Mol. Mass.:57248.42
Organism:Toxoplasma gondii
Description:n/a
Residue:507
Sequence:
MGQQESTLGGAAGEPRSRGHAAGTSGGPGDHLHATPGMFVQHSTAIFSDRYKGQRVLGKG
SFGEVILCKDKITGQECAVKVISKRQVKQKTDKESLLREVQLLKQLDHPNIMKLYEFFED
KGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIRQVLSGITYMHKNKIVHRDLKPENL
LLESKSKDANIRIIDFGLSTHFEASKKMKDKIGTAYYIAPEVLHGTYDEKCDVWSTGVIL
YILLSGCPPFNGANEYDILKKVEKGKYTFELPQWKKVSESAKDLIRKMLTYVPSMRISAR
DALDHEWIQTYTKEQISVDVPSLDNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKEL
TAIFHKMDKNGDGQLDRAELIEGYKELMRMKGQDASMLDASAVEHEVDQVLDAVDFDKNG
YIEYSEFVTVAMDRKTLLSRERLERAFRMFDSDNSGKISSTELATIFGVSDVDSETWKSV
LSEVDKNNDGEVDFDEFQQMLLKLCGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148652
NameBDBM50148652
Synonyms:CHEMBL3770802 | US9518026, Example 57
TypeSmall organic molecule
Emp. Form.C21H25N5O2
Mol. Mass.379.4555
SMILESCCOc1ccc2cc(ccc2n1)-c1nn(C2CCCCC2)c(N)c1C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a