Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4B
LigandBDBM50153069
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1561970
IC50 61±n/a nM
Citation Bavetsias, VLanigan, RMRuda, GFAtrash, BMcLaughlin, MGTumber, AMok, NYLe Bihan, YVDempster, SBoxall, KJJeganathan, FHatch, SBSavitsky, PVelupillai, SKrojer, TEngland, KSSejberg, JThai, CDonovan, APal, AScozzafava, GBennett, JMKawamura, AJohansson, CSzykowska, AGileadi, CBurgess-Brown, NAvon Delft, FOppermann, UWalters, ZShipley, JRaynaud, FIWestaway, SMPrinjha, RKFedorov, OBurke, RSchofield, CJWestwood, IMBountra, CMüller, Svan Montfort, RLBrennan, PEBlagg, J 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors. J Med Chem59:1388-409 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4B
Name:Lysine-specific demethylase 4B
Synonyms:1.14.11.- | JHDM3B | JMJD2B | JmjC domain-containing histone demethylation protein 3B | Jumonji domain-containing protein 2B | KDM4B | KIAA0876 | Lysine-specific demethylase 4B
Type:PROTEIN
Mol. Mass.:121904.33
Organism:Homo sapiens
Description:ChEMBL_109446
Residue:1096
Sequence:
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSA
SRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALW
LPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAF
NQEHVSCQQAFEHFAQKGPTWKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTF
SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQW
KNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPIASLGKGCPATLPSKS
RQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHASCYGIRPELVN
EGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVS
ITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDN
LYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKR
GDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVA
FVESLLQVQGRPGAPF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153069
n/a
NameBDBM50153069
Synonyms:CHEMBL3775953
TypeSmall organic molecule
Emp. Form.C23H23FN6O
Mol. Mass.418.4667
SMILESFc1ccc(cc1)C1CCN(CCc2cnn(c2)-c2nccc3c2nc[nH]c3=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: