Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 6 (5-HT6)
LigandBDBM50156199
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1563720
IC50 0.500000±n/a nM
Citation Blass, B Sulfonamide Derivatives and Pharmaceutical Applications Thereof. ACS Med Chem Lett7:12-4 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-Hydroxytryptamine receptor 6 (5-HT6)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 | 5-hydroxytryptamine receptor 6 (5-HT-6) | 5-hydroxytryptamine receptor 6 (5-HT6R) | 5-hydroxytryptamine receptor 6 (5HT6) | Serotonin (5-HT3) receptor | Serotonin 6 (5-HT6) receptor | Serotonin Receptor 6
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46968.43
Organism:Homo sapiens (Human)
Description:Cultured Hela cells expressing h5-HT6 receptors.
Residue:440
Sequence:
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156199
NameBDBM50156199
Synonyms:CHEMBL3779904
TypeSmall organic molecule
Emp. Form.C25H31N3O4S
Mol. Mass.469.596
SMILESCOc1ccc2cccc(CCNS(=O)(=O)c3ccc(OC)c(c3)N3CCN(C)CC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a