Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSteroid 17-alpha-hydroxylase/17,20 lyase
LigandBDBM50391846
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1563728
IC50 2.0±n/a nM
Citation Huang, AJayaraman, LFura, AVite, GDTrainor, GLGottardis, MMSpires, TESpires, VMRizzo, CAObermeier, MTElzinga, PATodderud, GFan, YNewitt, JABeyer, SMZhu, YWarrack, BMGoodenough, AKTebben, AJDoweyko, AMGold, DLBalog, A Discovery of the Selective CYP17A1 Lyase Inhibitor BMS-351 for the Treatment of Prostate Cancer. ACS Med Chem Lett7:40-5 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Steroid 17-alpha-hydroxylase/17,20 lyase
Name:Steroid 17-alpha-hydroxylase/17,20 lyase
Synonyms:17-alpha-hydroxyprogesterone aldolase | CYP17 | CYP17A1 | CYPXVII | Cytochrome P450 17A1 | Cytochrome P450-C17 | Cytochrome P450c17 | Steroid 17-alpha-hydroxylase/17,20 lyase
Type:PROTEIN
Mol. Mass.:57634.34
Organism:Macaca fascicularis
Description:ChEMBL_116757
Residue:508
Sequence:
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQVTTLDILSNNRKGIAFADYGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQTIDISFPVFVAITNVIS
LICFNISYKNGDPELKIVHNYNEGIIDSLGKESLVDLFPWLKVFPNKTLEKLKRHVKTRN
DLLTKIFENYKEKFHSDSITNMLDVLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWIVAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRIRPVAPMLIPHKANVDSSIGEFAVDKGTHVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSLSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGNP
KVVFLIDSFKVKIKVRQAWREAQAEGST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391846
NameBDBM50391846
Synonyms:CHEMBL2147041 | US9133160, 31
TypeSmall organic molecule
Emp. Form.C15H12F3N3
Mol. Mass.291.2711
SMILESCc1ccncc1-c1cccc2n(CC(F)(F)F)cnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a