Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome CYP26A1
LigandBDBM50157720
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1567869
IC50>5000±n/a nM
Citation Diaz, PHuang, WKeyari, CMButtrick, BPrice, LGuilloteau, NTripathy, SSperandio, VGFronczek, FRAstruc-Diaz, FIsoherranen, N Development and Characterization of Novel and Selective Inhibitors of Cytochrome P450 CYP26A1, the Human Liver Retinoic Acid Hydroxylase. J Med Chem59:2579-95 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome CYP26A1
Name:Cytochrome CYP26A1
Synonyms:Cytochrome P450 26A1 | Cytochrome P450 retinoic acid-inactivating 1 | Retinoic acid 4-hydroxylase
Type:Enzyme
Mol. Mass.:56216.16
Organism:Homo sapiens (Human)
Description:O43174
Residue:497
Sequence:
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157720
NameBDBM50157720
Synonyms:CHEMBL3786340
TypeSmall organic molecule
Emp. Form.C23H28O4S
Mol. Mass.400.531
SMILESCC1(C)CCC(C)(C)c2cc(ccc12)S(=O)(=O)c1ccc(CCC(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a