Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4B
LigandBDBM50158857
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1566331
IC50<250±n/a nM
Citation McAllister, TEEngland, KSHopkinson, RJBrennan, PEKawamura, ASchofield, CJ Recent Progress in Histone Demethylase Inhibitors. J Med Chem59:1308-29 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4B
Name:Lysine-specific demethylase 4B
Synonyms:1.14.11.- | JHDM3B | JMJD2B | JmjC domain-containing histone demethylation protein 3B | Jumonji domain-containing protein 2B | KDM4B | KIAA0876 | Lysine-specific demethylase 4B
Type:PROTEIN
Mol. Mass.:121904.33
Organism:Homo sapiens
Description:ChEMBL_109446
Residue:1096
Sequence:
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSA
SRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALW
LPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAF
NQEHVSCQQAFEHFAQKGPTWKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTF
SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQW
KNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPIASLGKGCPATLPSKS
RQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHASCYGIRPELVN
EGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVS
ITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDN
LYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKR
GDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVA
FVESLLQVQGRPGAPF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158857
n/a
NameBDBM50158857
Synonyms:CHEMBL3787547
TypeSmall organic molecule
Emp. Form.C15H25N3O
Mol. Mass.263.3785
SMILESCCN(CC)CCCCNCc1cc(C=O)ccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: