Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic, AMPA 4
LigandBDBM17657
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1569980
EC50 19600±n/a nM
Citation Wang, SYLarsen, YNavarrete, CVJensen, AANielsen, BAl-Musaed, AFrydenvang, KKastrup, JSPickering, DSClausen, RP Tweaking Subtype Selectivity and Agonist Efficacy at (S)-2-Amino-3-(3-hydroxy-5-methyl-isoxazol-4-yl)propionic acid (AMPA) Receptors in a Small Series of BnTetAMPA Analogues. J Med Chem59:2244-54 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic, AMPA 4
Name:Glutamate receptor ionotropic, AMPA 4
Synonyms:Glutamate receptors NMDA/AMPA
Type:PROTEIN
Mol. Mass.:100766.57
Organism:Rattus norvegicus
Description:ChEMBL_539474
Residue:902
Sequence:
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEATRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17657
NameBDBM17657
Synonyms:(2S)-2-aminopentanedioic acid | (S)-Glu | D-Glutamate | Glutamate | L-Glu | L-Glutamate | L-Glutamic acid | L-[14C(U)]glutamate | L-gluatmate
TypeAmino Acid
Emp. Form.C5H9NO4
Mol. Mass.147.1293
SMILESN[C@@H](CCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a