Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBranched-chain-amino-acid aminotransferase, mitochondrial
LigandBDBM50162497
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1570254
IC50<1258925±n/a nM
Citation Borthwick, JAAncellin, NBertrand, SMBingham, RPCarter, PSChung, CWChurcher, IDodic, NFournier, CFrancis, PLHobbs, AJamieson, CPickett, SDSmith, SESomers, DOSpitzfaden, CSuckling, CJYoung, RJ Structurally Diverse Mitochondrial Branched Chain Aminotransferase (BCATm) Leads with Varying Binding Modes Identified by Fragment Screening. J Med Chem59:2452-67 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Branched-chain-amino-acid aminotransferase, mitochondrial
Name:Branched-chain-amino-acid aminotransferase, mitochondrial
Synonyms:BCAT(m) | BCAT2 | BCATM | BCT2 | Branched-chain-amino-acid aminotransferase, mitochondrial | ECA40 | PP18 | Placental protein 18
Type:PROTEIN
Mol. Mass.:44297.81
Organism:Homo sapiens (Human)
Description:ChEMBL_109874
Residue:392
Sequence:
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
TMENGPELILRFQKELKEIQYGIRAHEWMFPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50162497
NameBDBM50162497
Synonyms:CHEMBL3793258
TypeSmall organic molecule
Emp. Form.C12H15NO2
Mol. Mass.205.253
SMILESOCC(=O)NC1CCCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a