Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 4
LigandBDBM50115362
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1576040
IC50 26±n/a nM
Citation Lensing, CJFreeman, KTSchnell, SMAdank, DNSpeth, RCHaskell-Luevano, C An in Vitro and in Vivo Investigation of Bivalent Ligands That Display Preferential Binding and Functional Activity for Different Melanocortin Receptor Homodimers. J Med Chem59:3112-28 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 4
Name:Melanocortin receptor 4
Synonyms:MC4-R
Type:PROTEIN
Mol. Mass.:36964.43
Organism:Mus musculus
Description:ChEMBL_1498850
Residue:332
Sequence:
MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLL
ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN
IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS
GVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTN
MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL
IYALRSQELRKTFKEIICFYPLGGICELSSRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115362
NameBDBM50115362
Synonyms:2-{2-[2-Acetylamino-3-(3H-imidazol-4-yl)-propionylamino]-3-naphthalen-2-yl-propionylamino}-5-guanidino-pentanoic acid [1-carbamoyl-2-(1H-indol-3-yl)-ethyl]-amide | CHEMBL103817
TypeSmall organic molecule
Emp. Form.C38H45N11O5
Mol. Mass.735.8346
SMILESCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccc2ccccc2c1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a