Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor
LigandBDBM50009073
Substrate/Competitorn/a
Meas. Tech.ChEBML_1579540
IC50 14±n/a nM
Citation Chen, HYang, HWang, ZXie, XNan, F Discovery of 3-Substituted 1H-Indole-2-carboxylic Acid Derivatives as a Novel Class of CysLT1 Selective Antagonists. ACS Med Chem Lett7:335-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor
Name:Cysteinyl leukotriene receptor
Synonyms:CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38565.16
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271
Residue:337
Sequence:
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009073
NameBDBM50009073
Synonyms:4-(5-cyclopentyloxycarbonylamino-1-methyl-1H-indol-3-ylmethyl)-3-methoxy-N-o-tolylsulfonylbenzamide | CHEMBL603 | ZAFIRLUKAST | cyclopentyl 3-(2-methoxy-4-((o-tolylsulfonyl)carbamoyl)benzyl)-1-methylindole-5-carbamate | cyclopentyl 3-[2-methoxy-4-(2-methylphenylsulfonylcarbamoyl)benzyl]-1-methyl-1H-indol-5-ylcarbamate
TypeSmall organic molecule
Emp. Form.C31H33N3O6S
Mol. Mass.575.675
SMILESCOc1cc(ccc1Cc1cn(C)c2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a