Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target14-3-3 protein beta/alpha
LigandBDBM50177028
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1582330
Kd 7.0±n/a nM
Citation Watanabe, NOsada, H Small molecules that target phosphorylation dependent protein-protein interaction. Bioorg Med Chem24:3246-54 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
14-3-3 protein beta/alpha
Name:14-3-3 protein beta/alpha
Synonyms:14-3-3 protein beta/alpha | 14-3-3 protein beta/alpha, N-terminally processed | KCIP-1 | Protein 1054 | Protein kinase C inhibitor protein 1 | YWHAB
Type:PROTEIN
Mol. Mass.:28068.98
Organism:Homo sapiens (Human)
Description:ChEMBL_112364
Residue:246
Sequence:
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177028
NameBDBM50177028
Synonyms:CHEMBL3814675
TypeSmall organic molecule
Emp. Form.C101H157N27O29S3
Mol. Mass.2309.686
SMILESCSCC[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H]1CCCN1)C(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a