Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-phosphoinositide dependent protein kinase-1
LigandBDBM50178295
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1583663
IC50 17000±n/a nM
Citation Wucherer-Plietker, MMerkul, EMüller, TJEsdar, CKnöchel, THeinrich, TBuchstaller, HPGreiner, HDorsch, DFinsinger, DCalderini, MBruge, DGrädler, U Discovery of novel 7-azaindoles as PDK1 inhibitors. Bioorg Med Chem Lett26:3073-80 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-phosphoinositide dependent protein kinase-1
Name:3-phosphoinositide dependent protein kinase-1
Synonyms:3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) | 3-phosphoinositide-dependent protein kinase 1 | 3-phosphoinositide-dependent protein kinase 1 (PDK) | 3-phosphoinositide-dependent protein kinase 1 (PDK-1) | 3-phosphoinositide-dependent protein kinase 1 (PDK1)(Δ1-50) | Isoform 2 of 3-phosphoinositide-dependent protein kinase 1 | PDK1 | PDPK1 | Phosphoinositide-dependent protein kinase 1 (PDK1) | Pyruvate dehydrogenase kinase isoenzyme 1 (PDK1) | hPDK1
Type:Enzyme
Mol. Mass.:63157.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:556
Sequence:
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50178295
NameBDBM50178295
Synonyms:CHEMBL3814512
TypeSmall organic molecule
Emp. Form.C6H9N5O2S
Mol. Mass.215.233
SMILESCSc1nn(C(N)=O)c(N)c1C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a