Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProteinase-activated receptor 1
LigandBDBM50181506
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1585283
IC50 10±n/a nM
Citation Eggert, EHillig, RCKoehr, SStöckigt, DWeiske, JBarak, NMowat, JBrumby, TChrist, CDTer Laak, ALang, TFernandez-Montalvan, AEBadock, VWeinmann, HHartung, IVBarsyte-Lovejoy, DSzewczyk, MKennedy, SLi, FVedadi, MBrown, PJSanthakumar, VArrowsmith, CHStellfeld, TStresemann, C Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (BAY-598) for the Protein Lysine Methyltransferase SMYD2. J Med Chem59:4578-600 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proteinase-activated receptor 1
Name:Proteinase-activated receptor 1
Synonyms:Coagulation factor II receptor | PAR-1 | Proteinase activated receptor 1 | Proteinase-activated receptor 1 (PAR-1) | Thrombin receptor | Thrombin receptor/ Proteinase-activated receptor 1(Par-1)
Type:Protein
Mol. Mass.:47450.07
Organism:Homo sapiens (Human)
Description:P25116
Residue:425
Sequence:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181506
NameBDBM50181506
Synonyms:CHEMBL3819038
TypeSmall organic molecule
Emp. Form.C23H24Cl2N6O2
Mol. Mass.487.382
SMILESCCN(C1CN(N=C1c1ccc(Cl)cc1)C(\NCCc1cccc(Cl)c1)=N/C#N)C(=O)CO |c:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a