Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-lysine methyltransferase SMYD2
LigandBDBM50181506
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1585277
IC50>20000±n/a nM
Citation Eggert, EHillig, RCKoehr, SStöckigt, DWeiske, JBarak, NMowat, JBrumby, TChrist, CDTer Laak, ALang, TFernandez-Montalvan, AEBadock, VWeinmann, HHartung, IVBarsyte-Lovejoy, DSzewczyk, MKennedy, SLi, FVedadi, MBrown, PJSanthakumar, VArrowsmith, CHStellfeld, TStresemann, C Discovery and Characterization of a Highly Potent and Selective Aminopyrazoline-Based in Vivo Probe (BAY-598) for the Protein Lysine Methyltransferase SMYD2. J Med Chem59:4578-600 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
N-lysine methyltransferase SMYD2
Name:N-lysine methyltransferase SMYD2
Synonyms:HSKM-B | Histone methyltransferase SMYD2 | KMT3C | Lysine N-methyltransferase 3C | N-lysine methyltransferase SMYD2 | SET and MYND domain-containing protein 2 | SMYD2
Type:Enzyme
Mol. Mass.:49689.57
Organism:Homo sapiens (Human)
Description:Q9NRG4
Residue:433
Sequence:
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
QYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181506
NameBDBM50181506
Synonyms:CHEMBL3819038
TypeSmall organic molecule
Emp. Form.C23H24Cl2N6O2
Mol. Mass.487.382
SMILESCCN(C1CN(N=C1c1ccc(Cl)cc1)C(\NCCc1cccc(Cl)c1)=N/C#N)C(=O)CO |c:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a