Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
LigandBDBM50181528
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1585632
Kd 12600±n/a nM
Citation Dennis, MLPitcher, NPLee, MDDeBono, AJWang, ZCHarjani, JRRahmani, RCleary, BPeat, TSBaell, JBSwarbrick, JD Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli. J Med Chem59:5248-63 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Name:2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Synonyms:2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase | 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase | HPPK | JW0138 | PPPK | folK
Type:PROTEIN
Mol. Mass.:18075.55
Organism:Escherichia coli (strain K12)
Description:ChEMBL_108237
Residue:159
Sequence:
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181528
NameBDBM50181528
Synonyms:CHEMBL3818245
TypeSmall organic molecule
Emp. Form.C14H15N5OS
Mol. Mass.301.367
SMILESCc1ccc(C)c(CSc2nc3c(nc(N)[nH]c3=O)[nH]2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a