Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50187585
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1590505
Ki>1000±n/a nM
Citation Szymanska, EDrabczynska, AKarcz, TMüller, CEKöse, MKarolak-Wojciechowska, JFruzinski, ASchabikowski, JDoroz-Plonka, AHandzlik, JKiec-Kononowicz, K Similarities and differences in affinity and binding modes of tricyclic pyrimido- and pyrazinoxanthines at human and rat adenosine receptors. Bioorg Med Chem24:4347-4362 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptor
Synonyms:Adora2b
Type:PROTEIN
Mol. Mass.:36378.84
Organism:Rattus norvegicus
Description:ChEMBL_32934
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50187585
n/a
NameBDBM50187585
Synonyms:CHEMBL3827074
TypeSmall organic molecule
Emp. Form.C28H40N6O3
Mol. Mass.508.6556
SMILESCCCCn1c2nc3N(CCCn3c2c(=O)n(CCCC)c1=O)c1ccc(OCCN2CCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: