Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2B adrenergic receptor
LigandBDBM50027031
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1614153
EC50 776±n/a nM
Citation Giusepponi, MECifani, CMicioni Di Bonaventura, MVMattioli, LHudson, ADiamanti, EDel Bello, FGiannella, MMammoli, VPaoletti, CDPiergentili, APigini, MQuaglia, W Combined Interactions with I ACS Med Chem Lett7:956-961 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2B adrenergic receptor
Name:Alpha-2B adrenergic receptor
Synonyms:ADRA2B | ADRA2L1 | ADRA2L1 | ADRA2RL1 | Adrenergic alpha2B | Adrenergic receptor alpha | Adrenergic, alpha-2B-, receptor [Homo sapiens] | Alpha-2 adrenergic receptor subtype C2 | Alpha-2B adrenoceptor | Alpha-2B adrenoreceptor | Alpha-2BAR
Type:Enzyme
Mol. Mass.:49579.89
Organism:Homo sapiens (Human)
Description:P18089
Residue:450
Sequence:
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027031
NameBDBM50027031
Synonyms:(2-Chloro-phenyl)-(4,5-dihydro-1H-imidazol-2-ylmethyl)-amine | CHEMBL51358
TypeSmall organic molecule
Emp. Form.C10H12ClN3
Mol. Mass.209.675
SMILESClc1ccccc1NCC1=NCCN1 |t:10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a