Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChromobox protein homolog 7
LigandBDBM50194477
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1616628
IC50 56±n/a nM
Citation Stuckey, JISimpson, CNorris-Drouin, JLCholensky, SHLee, JPasca, RCheng, NDickson, BMPearce, KHFrye, SVJames, LI Structure-Activity Relationships and Kinetic Studies of Peptidic Antagonists of CBX Chromodomains. J Med Chem59:8913-8923 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chromobox protein homolog 7
Name:Chromobox protein homolog 7
Synonyms:CBX7 | Chromobox protein homolog 7
Type:Protein
Mol. Mass.:28351.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:251
Sequence:
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50194477
NameBDBM50194477
Synonyms:CHEMBL3916023
TypeSmall organic molecule
Emp. Form.C49H77N7O10
Mol. Mass.924.1766
SMILESCCN(CC)CCCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccc(CNC(=O)OC(C)(C)C)cc1)NC(=O)c1ccc(cc1)C(C)(C)C)C(=O)N[C@@H](CO)C(=O)OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a