Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene A4 hydrolase
LigandBDBM50197085
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1619177
Ki 160±n/a nM
Citation Wittmann, SKKalinowsky, LKramer, JSBloecher, RKnapp, SSteinhilber, DPogoryelov, DProschak, EHeering, J Thermodynamic properties of leukotriene A Bioorg Med Chem24:5243-5248 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene A4 hydrolase
Name:Leukotriene A4 hydrolase
Synonyms:LTA-4 hydrolase | Leukotriene A(4) hydrolase | Leukotriene A-4 hydrolase (LTA4H)
Type:Hydrolase; metalloprotease
Mol. Mass.:69280.41
Organism:Homo sapiens (Human)
Description:Human recombinant LTA4H.
Residue:611
Sequence:
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50197085
NameBDBM50197085
Synonyms:CHEMBL3921982
TypeSmall organic molecule
Emp. Form.C16H19NO2
Mol. Mass.257.3276
SMILESCN(C)CCOc1ccc(Oc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a