Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 4
LigandBDBM50197712
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1619704
IC50 490±n/a nM
Citation Ebiike, HTaka, NMatsushita, MOhmori, MTakami, KHyohdoh, IKohchi, MHayase, TNishii, HMorikami, KNakanishi, YAkiyama, NShindoh, HIshii, NIsobe, TMatsuoka, H Discovery of [5-Amino-1-(2-methyl-3H-benzimidazol-5-yl)pyrazol-4-yl]-(1H-indol-2-yl)methanone (CH5183284/Debio 1347), An Orally Available and Selective Fibroblast Growth Factor Receptor (FGFR) Inhibitor. J Med Chem59:10586-10600 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 4
Name:Fibroblast growth factor receptor 4
Synonyms:CD_antigen: CD334 FGFR4 | FGFR-4 | Fibroblast growth factor receptor 4 (FGFR4) | JK2 | TKF
Type:Protein
Mol. Mass.:87957.45
Organism:Homo sapiens (Human)
Description:P22455
Residue:802
Sequence:
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50197712
NameBDBM50197712
Synonyms:CHEMBL3676329
TypeSmall organic molecule
Emp. Form.C20H15BrN6O
Mol. Mass.435.277
SMILESCc1nc2cc(ccc2[nH]1)-n1ncc(C(=O)c2cc3ccc(Br)cc3[nH]2)c1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a