Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 1
LigandBDBM50197689
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1619701
IC50 33±n/a nM
Citation Ebiike, HTaka, NMatsushita, MOhmori, MTakami, KHyohdoh, IKohchi, MHayase, TNishii, HMorikami, KNakanishi, YAkiyama, NShindoh, HIshii, NIsobe, TMatsuoka, H Discovery of [5-Amino-1-(2-methyl-3H-benzimidazol-5-yl)pyrazol-4-yl]-(1H-indol-2-yl)methanone (CH5183284/Debio 1347), An Orally Available and Selective Fibroblast Growth Factor Receptor (FGFR) Inhibitor. J Med Chem59:10586-10600 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 1
Name:Fibroblast growth factor receptor 1
Synonyms:BFGFR | Basic fibroblast growth factor receptor 1 | Basic fibroblast growth factor receptor 1 (FGFR1) | CD_antigen=CD331 | FGFR-1 | FGFR-1 Tyrosine Kinase | FGFR-1, (FL) | FGFR1 | Fibroblast growth factor receptor (FGFR) | Fibroblast growth factor receptor 1 (FGFR-1) | Fibroblast growth factor receptor 1 (FGFR1) | Fms-like tyrosine kinase 2 | N-sam | bFGF-R | c-fgr
Type:Receptor
Mol. Mass.:91861.70
Organism:Homo sapiens (human)
Description:Recombinant proteins were expressed in Spodoptera frugiperdera 21 (Sf 21) insect cells for the enzyme assay.
Residue:822
Sequence:
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50197689
NameBDBM50197689
Synonyms:CHEMBL3934547
TypeSmall organic molecule
Emp. Form.C19H14N6O
Mol. Mass.342.3541
SMILESNc1c(cnn1-c1ccc2nc[nH]c2c1)C(=O)c1cc2ccccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a