Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCat eye syndrome critical region protein 2
LigandBDBM50200385
Substrate/Competitorn/a
Meas. Tech.ChEBML_1622060
IC50>20000±n/a nM
Citation Crawford, TDRomero, FALai, KWTsui, VTaylor, AMde Leon Boenig, GNoland, CLMurray, JLy, JChoo, EFHunsaker, TLChan, EWMerchant, MKharbanda, SGascoigne, KEKaufman, SBeresini, MHLiao, JLiu, WChen, KXChen, ZConery, ARCôté, AJayaram, HJiang, YKiefer, JRKleinheinz, TLi, YMaher, JPardo, EPoy, FSpillane, KLWang, FWang, JWei, XXu, ZXu, ZYen, IZawadzke, LZhu, XBellon, SCummings, RCochran, AGAlbrecht, BKMagnuson, S Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300. J Med Chem59:10549-10563 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cat eye syndrome critical region protein 2
Name:Cat eye syndrome critical region protein 2
Synonyms:CECR2 | Cat eye syndrome critical region protein 2 | KIAA1740
Type:PROTEIN
Mol. Mass.:164223.89
Organism:Homo sapiens (Human)
Description:ChEMBL_107999
Residue:1484
Sequence:
MCPEEGGAAGLGELRSWWEVPAIAHFCSLFRTAFRLPDFEIEELEAALHRDDVEFISDLI
ACLLQGCYQRRDITPQTFHSYLEDIINYRWELEEGKPNPLREASFQDLPLRTRVEILHRL
CDYRLDADDVFDLLKGLDADSLRVEPLGEDNSGALYWYFYGTRMYKEDPVQGKSNGELSL
SRESEGQKNVSSIPGKTGKRRGRPPKRKKLQEEILLSEKQEENSLASEPQTRHGSQGPGQ
GTWWLLCQTEEEWRQVTESFRERTSLRERQLYKLLSEDFLPEICNMIAQKGKRPQRTKAE
LHPRWMSDHLSIKPVKQEETPVLTRIEKQKRKEEEEERQILLAVQKKEQEQMLKEERKRE
LEEKVKAVEGMCSVRVVWRGACLSTSRPVDRAKRRKLREERAWLLAQGKELPPELSHLDP
NSPMREEKKTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMD
ISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKHFP
GEDGDTDEEFWIREDEKREKRRSRAGRSGGSHVWTRSRDPEGSSRKQQPMENGGKSLPPT
RRAPSSGDDQSSSSTQPPREVGTSNGRGFSHPLHCGGTPSQAPFLNQMRPAVPGTFGPLR
GSDPATLYGSSGVPEPHPGEPVQQRQPFTMQPPVGINSLRGPRLGTPEEKQMCGGLTHLS
NMGPHPGSLQLGQISGPSQDGSMYAPAQFQPGFIPPRHGGAPARPPDFPESSEIPPSHMY
RSYKYLNRVHSAVWNGNHGATNQGPLGPDEKPHLGPGPSHQPRTLGHVMDSRVMRPPVPP
NQWTEQSGFLPHGVPSSGYMRPPCKSAGHRLQPPPVPAPSSLFGAPAQALRGVQGGDSMM
DSPEMIAMQQLSSRVCPPGVPYHPHQPAHPRLPGPFPQVAHPMSVTVSAPKPALGNPGRA
PENSEAQEPENDQAEPLPGLEEKPPGVGTSEGVYLTQLPHPTPPLQTDCTRQSSPQERET
VGPELKSSSSESADNCKAMKGKNPWPSDSSYPGPAAQGCVRDLSTVADRGALSENGVIGE
ASPCGSEGKGLGSSGSEKLLCPRGRTLQETMPCTGQNAATPPSTDPGLTGGTVSQFPPLY
MPGLEYPNSAAHYHISPGLQGVGPVMGGKSPASHPQHFPPRGFQSNHPHSGGFPRYRPPQ
GMRYSYHPPPQPSYHHYQRTPYYACPQSFSDWQRPLHPQGSPSGPPASQPPPPRSLFSDK
NAMASLQGCETLNAALTSPTRMDAVAAKVPNDGQNPGPEEEKLDESMERPESPKEFLDLD
NHNAATKRQSSLSASEYLYGTPPPLSSGMGFGSSAFPPHSVMLQTGPPYTPQRPASHFQP
RAYSSPVAALPPHHPGATQPNGLSQEGPIYRCQEEGLGHFQAVMMEQIGTRSGIRGPFQE
MYRPSGMQMHPVQSQASFPKTPTAATSQEEVPPHKPPTLPLDQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50200385
NameBDBM50200385
Synonyms:CHEMBL3959584
TypeSmall organic molecule
Emp. Form.C14H16N4O
Mol. Mass.256.303
SMILESCC(=O)N1CCc2[nH]nc(Nc3ccccc3)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a