Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4
LigandBDBM50200386
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1622038
IC50 9800±n/a nM
Citation Crawford, TDRomero, FALai, KWTsui, VTaylor, AMde Leon Boenig, GNoland, CLMurray, JLy, JChoo, EFHunsaker, TLChan, EWMerchant, MKharbanda, SGascoigne, KEKaufman, SBeresini, MHLiao, JLiu, WChen, KXChen, ZConery, ARCôté, AJayaram, HJiang, YKiefer, JRKleinheinz, TLi, YMaher, JPardo, EPoy, FSpillane, KLWang, FWang, JWei, XXu, ZXu, ZYen, IZawadzke, LZhu, XBellon, SCummings, RCochran, AGAlbrecht, BKMagnuson, S Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300. J Med Chem59:10549-10563 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4
Name:BRD4/HDAC1
Synonyms:BRD4 | Bromodomain-containing protein 4 (BRD4) | HUNK1 | Protein HUNK1
Type:Protein
Mol. Mass.:152264.84
Organism:Homo sapiens (Human)
Description:O60885
Residue:1362
Sequence:
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE
MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP
PPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL
PQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP
PPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI
KAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG
SWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM
LDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50200386
NameBDBM50200386
Synonyms:CHEMBL3909879
TypeSmall organic molecule
Emp. Form.C20H26N4O
Mol. Mass.338.4466
SMILESCC(=O)N1CCc2c(C1)c(Nc1cccc(C)c1)nn2CCC1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a