Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity phosphatase Cdc25B
LigandBDBM50391109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1625486
IC50 0.910000±n/a nM
Citation Meng, GZheng, MWang, MTong, JGe, WZhang, JZheng, ALi, JGao, LLi, J Design and synthesis of new potent PTP1B inhibitors with the skeleton of 2-substituted imino-3-substituted-5-heteroarylidene-1,3-thiazolidine-4-one: Part I. Eur J Med Chem122:756-769 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity phosphatase Cdc25B
Name:Dual specificity phosphatase Cdc25B
Synonyms:Dual specificity phosphatase (CDC25B) | M-phase inducer phosphatase 2 (CDC25B)
Type:Protein
Mol. Mass.:64985.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:580
Sequence:
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391109
NameBDBM50391109
Synonyms:CHEMBL179166 | Sodium orthovanadate (SOV) | Vanadates
TypeSmall organic molecule
Emp. Form.O4V
Mol. Mass.114.9407
SMILES[O-][V]([O-])([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a