Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFree fatty acid receptor 4
LigandBDBM50203653
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1632270
EC50 16±n/a nM
Citation Cox, JMChu, HDChelliah, MVDebenham, JSEagen, KLan, PLombardo, MLondon, CPlotkin, MAShah, USun, ZVaccaro, HMVenkatraman, SSuzuki, TWang, NAshley, ERCrespo, AMadeira, MLeung, DHAlleyne, COgawa, AMSouza, SThomas-Fowlkes, BDi Salvo, JWeinglass, AKirkland, MPachanski, MPowles, MATozzo, EAkiyama, TEUjjainwalla, FTata, JRSinz, CJ Design, Synthesis, and Evaluation of Novel and Selective G-protein Coupled Receptor 120 (GPR120) Spirocyclic Agonists. ACS Med Chem Lett8:49-54 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Free fatty acid receptor 4
Name:G-protein coupled receptor 120
Synonyms:FFAR4 | G-protein coupled receptor 120 | G-protein coupled receptor 129 | G-protein coupled receptor GT01 | G-protein coupled receptor PGR4 | GPR120 | GPR129 | O3FAR1 | Omega-3 fatty acid receptor 1 | PGR4
Type:PROTEIN
Mol. Mass.:42256.91
Organism:Homo sapiens
Description:ChEMBL_1508994
Residue:377
Sequence:
MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVC
ALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTL
SGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVV
PQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDA
RAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITI
LLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGA
ILTDTSVKRNDLSIISG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50203653
NameBDBM50203653
Synonyms:CHEMBL3896657
TypeSmall organic molecule
Emp. Form.C18H12F4O4
Mol. Mass.368.2791
SMILESOC(=O)CCc1cc2cc(ccc2o1)-c1cc(OC(F)(F)F)ccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a