Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM10755
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1633599
IC50 4.9±n/a nM
Citation Gunia-Krzyzak, AZelaszczyk, DRapacz, AZeslawska, EWaszkielewicz, AMPanczyk, KSloczynska, KPekala, ENitek, WFilipek, BMarona, H Structure-anticonvulsant activity studies in the group of (E)-N-cinnamoyl aminoalkanols derivatives monosubstituted in phenyl ring with 4-Cl, 4-CH Bioorg Med Chem25:471-482 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a