Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-protein thioesterase 2
LigandBDBM50212217
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1636766
Ki>10000±n/a nM
Citation Won, SJEschweiler, JDMajmudar, JDChong, FSHwang, SYRuotolo, BTMartin, BR Affinity-Based Selectivity Profiling of an In-Class Selective Competitive Inhibitor of Acyl Protein Thioesterase 2. ACS Med Chem Lett8:215-220 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-protein thioesterase 2
Name:Acyl-protein thioesterase 2
Synonyms:Acyl-protein thioesterase 2 (APT2 WT) | Lysophospholipase II
Type:Protein
Mol. Mass.:24740.23
Organism:Homo sapiens (Human)
Description:O95372
Residue:231
Sequence:
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212217
NameBDBM50212217
Synonyms:CHEMBL3917640
TypeSmall organic molecule
Emp. Form.C43H54N8O9S3
Mol. Mass.923.132
SMILES[H][C@]12CS[C@@H](CCCCC(=O)NCCOCCOCCOCCn3cc(COc4ccccc4N4CCN(CC4)C(=O)c4cc5CS(=O)(=O)c6ccccc6-c5s4)nn3)[C@@]1([H])NC(=O)N2 |r|
Structure
n/a