BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM50036844
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1826
IC50 0.000000±n/a nM
Citation  TBA Bioorg Med Chem Lett3:1935-1940 (1993)  
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036844
NameBDBM50036844
Synonyms:2-{4-[(5-Methoxy-chroman-3-yl)-propyl-amino]-butyl}-isoindole-1,3-dione; compound with oxalic acid | CHEMBL52396
TypeSmall organic molecule
Emp. Form.C25H30N2O4
Mol. Mass.422.5167
SMILESCCCN(CCCCN1C(=O)c2ccccc2C1=O)C1COc2cccc(OC)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a