Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor
LigandBDBM50009073
Substrate/Competitorn/a
Meas. Tech.ChEMBL_98640
Ki 2±n/a nM
Citation Chambers, RJAntognoli, GWCheng, JBMarfat, APillar, JSShirley, JTWatson, JW Development of new chromanol antagonists of leukotriene D4. Bioorg Med Chem Lett8:1791-6 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor
Name:Cysteinyl leukotriene receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 98640
Components:This complex has 2 components.
Component 1
Name:Cysteinyl leukotriene receptor
Synonyms:CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38565.16
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271
Residue:337
Sequence:
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cysteinyl leukotriene receptor
Synonyms:Cysteinyl leukotriene receptor 2 | Leukotriene Cysteinyl 2
Type:Enzyme Catalytic Domain
Mol. Mass.:39657.52
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 2 CYSLTR2 HUMAN::Q9NS75
Residue:346
Sequence:
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009073
NameBDBM50009073
Synonyms:4-(5-cyclopentyloxycarbonylamino-1-methyl-1H-indol-3-ylmethyl)-3-methoxy-N-o-tolylsulfonylbenzamide | CHEMBL603 | ZAFIRLUKAST | cyclopentyl 3-(2-methoxy-4-((o-tolylsulfonyl)carbamoyl)benzyl)-1-methylindole-5-carbamate | cyclopentyl 3-[2-methoxy-4-(2-methylphenylsulfonylcarbamoyl)benzyl]-1-methyl-1H-indol-5-ylcarbamate
TypeSmall organic molecule
Emp. Form.C31H33N3O6S
Mol. Mass.575.675
SMILESCOc1cc(ccc1Cc1cn(C)c2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a