Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C
LigandBDBM50220998
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157378
Ki 0.046000±n/a nM
Citation Kim, EChun, HOJung, SHKim, JHLee, JMSuh, BCXiang, MXRhee, CK Improvement of therapeutic index of phosphodiesterase type IV inhibitors as anti-Asthmatics. Bioorg Med Chem Lett13:2355-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Synonyms:DPDE1 | Dpde1 | Pde4c | cAMP-specific 3'',5''-cyclic phosphodiesterase 4C
Type:PROTEIN
Mol. Mass.:60038.21
Organism:Rattus norvegicus
Description:ChEMBL_104732
Residue:536
Sequence:
NSSRTSSAASDLHGEDMIVTPFAQVLASLRTVRSNVAALAHGAGSATRQALLGTPPQSSQ
QAAPAEESGLQLAQETLEELDWCLEQLETLQTRRSVGEMASNKFKRMLNRELTHLSETSR
SGNQVSEYISQTFLDQQAEVELPAPPTEDHPWPMAQITGLRKSCHTSLPTAAIPRFGVQT
DQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAVIFRVLQERDLLKTFQIPADTLLRYL
LTLEGHYHSNVAYHNSIHAADVVQSAHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPG
VSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFQNLSTKQKLSLRRMVID
MVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQSLVHCADLSNPAKPL
PLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWAD
LVHPDAQELLDTLEDNREWYQSRVPCSPPHAIGPDRFKFELTLEETEEEEEEDERH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50220998
NameBDBM50220998
Synonyms:CHEMBL76382
TypeSmall organic molecule
Emp. Form.C14H19N3O2S
Mol. Mass.293.385
SMILESCOc1ccc(\C=N\N=C(\N)S)cc1OC1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a