Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlcohol dehydrogenase
LigandBDBM50224864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30849
Ki 250000±n/a nM
Citation Chadha, VKLeidal, KGPlapp, BV Inhibition by carboxamides and sulfoxides of liver alcohol dehydrogenase and ethanol metabolism. J Med Chem26:916-22 (1983) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alcohol dehydrogenase
Name:Alcohol dehydrogenase
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 30849
Components:This complex has 2 components.
Component 1
Name:Alcohol dehydrogenase E chain
Synonyms:1.1.1.1 | Alcohol dehydrogenase E chain
Type:PROTEIN
Mol. Mass.:39942.66
Organism:Equus caballus
Description:ChEMBL_105061
Residue:375
Sequence:
MSTAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT
PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMP
RGTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATE
CVNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQ
NLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGF
DLLRSGESIRTILTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Alcohol dehydrogenase S chain
Synonyms:1.1.1.1 | Alcohol dehydrogenase S chain
Type:PROTEIN
Mol. Mass.:39633.49
Organism:Equus caballus
Description:ChEMBL_105061
Residue:374
Sequence:
MSTAGKVIKCKAAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVA
PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCLKNLSMPR
GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGY
GSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC
VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVGVPPDSQN
LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD
LLRSGKSIRTILTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224864
NameBDBM50224864
Synonyms:CYCLOHEXANE CARBOXAMIDE | Cyclohexanecarboxylic Acid Amide
TypeSmall organic molecule
Emp. Form.C7H13NO
Mol. Mass.127.1842
SMILESNC(=O)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a