Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlcohol dehydrogenase S chain
LigandBDBM50224866
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30984
Ki 169824±n/a nM
Citation Hansch, CKlein, TMcClarin, JLangridge, RCornell, NW A quantitative structure-activity relationship and molecular graphics analysis of hydrophobic effects in the interactions of inhibitors with alcohol dehydrogenase. J Med Chem29:615-20 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alcohol dehydrogenase S chain
Name:Alcohol dehydrogenase S chain
Synonyms:1.1.1.1 | Alcohol dehydrogenase S chain
Type:PROTEIN
Mol. Mass.:39633.49
Organism:Equus caballus
Description:ChEMBL_105061
Residue:374
Sequence:
MSTAGKVIKCKAAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVA
PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCLKNLSMPR
GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGY
GSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC
VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVGVPPDSQN
LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD
LLRSGKSIRTILTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224866
NameBDBM50224866
Synonyms:ISOBUTYRAMIDE | Isobutyramide
TypeSmall organic molecule
Emp. Form.C4H9NO
Mol. Mass.87.1204
SMILESCC(C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a