Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM50229337
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195076
IC50>1000±n/a nM
Citation Moriya, TKurita, HMatsumoto, KOtake, TMori, HMorimoto, MUeba, NKunita, N Potent inhibitory effect of a series of modified cyclodextrin sulfates (mCDS) on the replication of HIV-1 in vitro. J Med Chem34:2301-4 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229337
NameBDBM50229337
Synonyms:CHEMBL3706384
TypeSmall organic molecule
Emp. Form.C51H64K16O85S17
Mol. Mass.3207.681
SMILES[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[K+].[H][C@@]12OC(COS([O-])(=O)=O)[C@@]([H])(O[C@@]3([H])OC(COS([O-])(=O)=O)[C@@]([H])(O[C@]4([H])OC(COS([O-])(=O)=O)[C@@]([H])(O[C@@]5([H])OC(COS([O-])(=O)=O)[C@@]([H])(O[C@@]6([H])OC(COS([O-])(=O)=O)[C@@]([H])(O[C@@]7([H])OC(COS([O-])(=O)=O)[C@@]([H])(O[C@@]8([H])OC(COS(=O)(=O)c9c(C)cc(C)cc9C)[C@@]([H])(O1)C(O)C8OS([O-])(=O)=O)C(O)C7OS([O-])(=O)=O)C(OS([O-])(=O)=O)C6OS([O-])(=O)=O)C(O)C5OS([O-])(=O)=O)C(OS([O-])(=O)=O)C4OS([O-])(=O)=O)C(OS([O-])(=O)=O)C3OS([O-])(=O)=O)C(O)C2OS([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a