Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidine kinase
LigandBDBM50229850
Substrate/Competitorn/a
Meas. Tech.ChEMBL_208025
IC50 1514±n/a nM
Citation Gambino, JFocher, FHildebrand, CMaga, GNoonan, TSpadari, SWright, G Quantitative structure-activity relationships of N2-phenylguanines as inhibitors of herpes simplex virus thymidine kinases. J Med Chem35:2979-83 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thymidine kinase
Name:Thymidine kinase
Synonyms:TK | Thymidine kinase | UL23
Type:PROTEIN
Mol. Mass.:40883.42
Organism:Human herpesvirus 1 (strain SC16) (HHV-1) (Human herpes simplex virus1)
Description:ChEMBL_213
Residue:376
Sequence:
MASYPGHQHASAFDQAARSRGHSNRRTALRPRRQQEATEVRPEQKMPTLLRVYIDGPHGM
GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVV
MTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMG
SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG
LLANTVRYLQGGGSWREDWGQLSGTAVPPQGAEPQSNAGPRPHIGDTLFTLFRAPELLAP
NGDLYNVFAWALDVLAKRLRPMHVFILDYDQSPAGCRDALLQLTSGMIQTHVTTPGSIPT
ICDLARTFAREMGEAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229850
NameBDBM50229850
Synonyms:CHEMBL406300
TypeSmall organic molecule
Emp. Form.C11H8BrN5O
Mol. Mass.306.118
SMILESOc1[nH]c(Nc2cccc(Br)c2)nc2ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a