Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2 and M4
LigandBDBM50229871
Substrate/Competitorn/a
Meas. Tech.ChEMBL_222724
Kd 21380±n/a nM
Citation Bravo, PResnati, GAngeli, PFrigerio, MViani, FArnone, AMarucci, GCantalamessa, F Synthesis and pharmacological evaluation of enantiomerically pure 4-deoxy-4-fluoromuscarines. J Med Chem35:3102-10 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2 and M4
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229871
NameBDBM50229871
Synonyms:CHEMBL316804
TypeSmall organic molecule
Emp. Form.C9H19FINO
Mol. Mass.303.1561
SMILES[I-].C[C@@H]1O[C@H](C[N+](C)(C)C)C[C@H]1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a