Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50006243
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138192
Kd 1122±n/a nM
Citation Bravo, PResnati, GAngeli, PFrigerio, MViani, FArnone, AMarucci, GCantalamessa, F Synthesis and pharmacological evaluation of enantiomerically pure 4-deoxy-4-fluoromuscarines. J Med Chem35:3102-10 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M3
Synonyms:GPM3 | Muscarinic acetylcholine receptor
Type:n/a
Mol. Mass.:66272.13
Organism:Cavia porcellus
Description:n/a
Residue:587
Sequence:
MTLHSNSTTLPLFPNISTSWIHSPSEAGLPPGTVTHFGSYNISQAAGNFSSLNGTTSDPL
GGHTIWQVVFIAFLTGFLALVTIIGNILVIVSFKVNKQLKHVNNYFLLSLADLIIGVISM
NLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTT
KRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYM
PVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSLKH
SSRRKYSRCHFWFATKSWKPNAGQMDQDHSSSDSWNNYDAAASLENSASDEEDIGSETRA
IYSIVLKLPGHSTILNSTKLPSSDNLQVPEEDLEPMDMERNASKPQTQKSMDDGGSFQKS
FSNLPIQLESTMDTAKTSDANSSVSKTMATLPLSFKEATLAKRFALRTRSQITKRKRMSL
IKEKRAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVC
YALCNKTFRNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006243
NameBDBM50006243
Synonyms:((2S,4R,5S)-4-Hydroxy-5-methyl-tetrahydro-furan-2-ylmethyl)-trimethyl-ammonium | (4-Hydroxy-5-methyl-tetrahydro-furan-2-ylmethyl)-trimethyl-ammonium; iodide | CHEMBL12587 | CHEMBL292911
TypeSmall organic molecule
Emp. Form.C9H20NO2
Mol. Mass.174.2601
SMILESC[C@@H]1O[C@H](C[N+](C)(C)C)C[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a