Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
LigandBDBM50229880
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155689
IC50 81000±n/a nM
Citation Bonnet, PAMichel, ALaurent, FSablayrolles, CRechencq, EMani, JCBoucard, MChapat, JP Synthesis and antibronchospastic activity of 8-alkoxy- and 8-(alkylamino)imidazo[1,2-a]pyrazines. J Med Chem35:3353-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
Name:Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
Synonyms:63 kDa Cam-PDE | Calcium/calmodulin-dependent 3'',5''-cyclic nucleotide phosphodiesterase 1B | Cam-PDE 1B | PDE1B | PDE1B1
Type:PROTEIN
Mol. Mass.:60991.90
Organism:Bos taurus
Description:ChEMBL_104913
Residue:534
Sequence:
MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEVNIEELKKNLE
YTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQTRAKGPSEEKPKF
RSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNVDLWCFDVFSLNRAADDHALRT
IVFELLTRHNLISRFKIPTVFLMTFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRT
GMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVFR
MMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKSMKTALQQLERIDKSKAL
SLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQI
GFIDFIVEPTFSVLTDVAEKSVQPTGDDDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFR
STWTKYIQENKQKWKERAASGITNQMSIDELSPCEEEAPASPAEDEHNQNGNLD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229880
NameBDBM50229880
Synonyms:CHEMBL116115
TypeSmall organic molecule
Emp. Form.C8H9BrN4
Mol. Mass.241.088
SMILESCCNc1nc(Br)cn2ccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a