Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuteinizing hormone/Choriogonadotropin receptor
LigandBDBM50230128
Substrate/Competitorn/a
Meas. Tech.ChEMBL_100017
Ki 0.380189±n/a nM
Citation Haviy, FFitzpatrick, TDNichols, CJSwenson, REBush, ENDiaz, GNguyen, ANellans, HNHoffman, DJGhanbari, H Stabilization of the N-terminal residues of luteinizing hormone-releasing hormone agonists and the effect on pharmacokinetics. J Med Chem35:3890-4 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Luteinizing hormone/Choriogonadotropin receptor
Name:Luteinizing hormone/Choriogonadotropin receptor
Synonyms:LH/CG-R | LSH-R | Luteinizing hormone receptor | Lutropin-choriogonadotropic hormone receptor
Type:PROTEIN
Mol. Mass.:78049.26
Organism:Rattus norvegicus
Description:ChEMBL_97289
Residue:700
Sequence:
MGRRVPALRQLLVLAVLLLKPSQLQSRELSGSRCPEPCDCAPDGALRCPGPRAGLARLSL
TYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEP
GAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNES
VTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQA
LPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSI
FENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDI
MGYAFLRVLIWLINILAIFGNLTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIA
SVDSQTKGQYYNHAIDWQTGSGCGAAGFFTVFASELSVYTLTVITLERWHTITYAVQLDQ
KLRLRHAIPIMLGGWLFSTLIATMPLVGISNYMKVSICLPMDVESTLSQVYILSILILNV
VAFVVICACYIRIYFAVQNPELTAPNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKV
PLITVTNSKILLVLFYPVNSCANPFLYAIFTKAFQRDFLLLLSRFGCCKRRAELYRRKEF
SAYTSNCKNGFPGASKPSQATLKLSTVHCQQPIPPRALTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50230128
NameBDBM50230128
Synonyms:CHEMBL437798
TypeSmall organic molecule
Emp. Form.C65H87N17O12
Mol. Mass.1298.493
SMILESCCNC(=O)[C@H]1CCCN1C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)N(C)C(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CN(C)C(C)=O |wU:64.80,45.57,31.44,23.28,5.4,wD:12.20,78.91,57.61,(25.45,-7.16,;25.84,-8.64,;27.33,-9.06,;28.4,-10.16,;29.9,-9.79,;27.98,-11.65,;28.92,-12.86,;28.05,-14.15,;26.58,-13.71,;26.52,-12.17,;25.24,-11.31,;25.35,-9.77,;23.86,-11.99,;23.75,-13.53,;25.03,-14.39,;24.91,-15.92,;26.19,-16.78,;26.07,-18.33,;27.37,-19.2,;24.7,-19,;22.58,-11.11,;21.2,-11.79,;21.08,-13.34,;19.92,-10.93,;20.01,-9.39,;21.4,-8.72,;21.52,-7.18,;22.68,-9.58,;18.52,-11.6,;17.25,-10.74,;17.35,-9.21,;15.85,-11.41,;15.75,-12.95,;16.5,-14.29,;18,-14.62,;18.15,-16.15,;16.76,-16.76,;16.27,-18.2,;14.78,-18.52,;13.76,-17.38,;14.24,-15.92,;15.74,-15.62,;14.57,-10.56,;13.2,-11.23,;13.08,-12.76,;11.92,-10.37,;12.02,-8.83,;13.41,-8.14,;13.52,-6.61,;14.9,-5.93,;16.18,-6.79,;17.57,-6.12,;16.08,-8.34,;14.69,-9.01,;10.53,-11.04,;9.25,-10.18,;9.35,-8.63,;7.86,-10.85,;7.74,-12.39,;9.04,-13.25,;6.58,-9.99,;6.68,-8.46,;5.19,-10.66,;5.07,-12.2,;3.91,-9.79,;4.03,-8.26,;5.41,-7.58,;6.95,-7.37,;7.21,-5.85,;5.85,-5.12,;5.49,-3.63,;4,-3.19,;2.89,-4.26,;3.26,-5.76,;4.74,-6.19,;2.53,-10.46,;1.24,-9.6,;1.36,-8.07,;-.13,-10.28,;-.25,-11.83,;1.03,-12.68,;1.08,-14.23,;2.56,-14.66,;3.42,-13.38,;2.47,-12.16,;-1.42,-9.42,;-2.8,-10.09,;-2.92,-11.64,;-3.97,-9.3,;-5.09,-10.11,;-5.2,-11.65,;-6.18,-9.02,;-5.5,-7.65,;-7.71,-9.28,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a