Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 6
LigandBDBM50004172
Substrate/Competitorn/a
Meas. Tech.ChEMBL_47171
IC50 23±n/a nM
Citation Lo, YSNolan, JCMaren, THWelstead, WJGripshover, DFShamblee, DA Synthesis and physicochemical properties of sulfamate derivatives as topical antiglaucoma agents. J Med Chem35:4790-4 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 6
Name:Carbonic anhydrase 6
Synonyms:CA-VI | CA6 | Carbonate dehydratase VI | Carbonic anhydrase 6 | Carbonic anhydrase VI | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:PROTEIN
Mol. Mass.:37008.14
Organism:Bos taurus
Description:ChEMBL_104851
Residue:319
Sequence:
MITLLFLLVVGAQAQHEWTYSEGVLDEKHWRLQYPDCGGTRQSPIDLKMKKVRYNPSLRA
LNLTGYGLRQGEFPMTNNGHTVQISLPSSMRMTTSDGSQYLAKQMHFHWGGDSSEISGSE
HTVDGMRYIIEIHVVHYHSKYGSYEEAQNEPDGLAVLAALVEVKDYAENTYYSNFISHLE
DIRYAGQSTVLRDLDIQDMLPGDLRYYYSYLGSLTTPSCTENVHWFVVADTVKLSKTQIE
KLENSLLNHQNETIQNNYRSTQPLNHRVVEANFVSHPHQEYTLGSKLHFYLNNIDQNLEY
LRRFIEQKITKRKKEKYWP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004172
NameBDBM50004172
Synonyms:CHEMBL544763 | Sulfamic acid 2-(4-imidazol-1-yl-phenoxy)-ethyl ester; hydrochloride
TypeSmall organic molecule
Emp. Form.C11H13N3O4S
Mol. Mass.283.304
SMILESNS(=O)(=O)OCCOc1ccc(cc1)-n1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a