Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSimilar to alpha-tubulin isoform 1
LigandBDBM50230625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_211320
IC50 3800±n/a nM
Citation Getahun, ZJurd, LChu, PSLin, CMHamel, E Synthesis of alkoxy-substituted diaryl compounds and correlation of ring separation with inhibition of tubulin polymerization: differential enhancement of inhibitory effects under suboptimal polymerization reaction conditions. J Med Chem35:1058-67 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Similar to alpha-tubulin isoform 1
Name:Similar to alpha-tubulin isoform 1
Synonyms:Similar to alpha-tubulin isoform 1
Type:PROTEIN
Mol. Mass.:10383.05
Organism:Bos taurus
Description:ChEMBL_104716
Residue:99
Sequence:
CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50230625
NameBDBM50230625
Synonyms:CHEMBL10686
TypeSmall organic molecule
Emp. Form.C18H20O4
Mol. Mass.300.349
SMILESCOc1ccc(CCCc2cc3OCOc3cc2OC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a