Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50230681
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48424
Ki 2.2±n/a nM
Citation Higginbottom, MKneen, CRatcliffe, GS Rationally designed"dipeptoid" analogues of CCK. A Free-Wilson/Fujita-Ban analysis of some alpha-methyltryptophan derivatives as CCK-B antagonists. J Med Chem35:1572-7 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin A | Gastrin/cholecystokinin type B receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49196.59
Organism:MOUSE
Description:Cholecystokinin A CCKBR MOUSE::P56481
Residue:453
Sequence:
MDLLKLNRSLQGPGPGSGSSLCRPGVSLLNSSSAGNLSCETPRIRGTGTRELELTIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLNLAAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTVVQPVGPRILQCMHLWPSERVQQMWSVLLLILLFFIPGVVMAVAYGL
ISRELYLGLRFDGDNDSETQSRVRNQGGLPGGAAAPGPVHQNGGCRHVTSLTGEDSDGCY
VQLPRSRLEMTTLTTPTTGPGPGPRPNQAKLLAKKRVVRMLLVIVLLFFVCWLPVYSANT
WRAFDGPGARRALAGAPISFIHLLSYTSACANPLVYCFMHRRFRQACLDTCARCCPRPPR
ARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50230681
NameBDBM50230681
Synonyms:CHEMBL3351023
TypeSmall organic molecule
Emp. Form.C35H42N4O6
Mol. Mass.614.7312
SMILESC[C@](Cc1c[nH]c2ccccc12)(NC(=O)O[C@H]1CC2CCC1(C)C2(C)C)C(=O)NC[C@H](NC(=O)\C=C\C(O)=O)c1ccccc1 |THB:15:16:23:20.19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a