Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReceptor-interacting protein 1 (RIPK1)
LigandBDBM50229509
Substrate/Competitorn/a
Meas. Tech.ChEBML_1644186
EC50>10000±n/a nM
Citation Ren, YSu, YSun, LHe, SMeng, LLiao, DLiu, XMa, YLiu, CLi, SRuan, HLei, XWang, XZhang, Z Discovery of a Highly Potent, Selective, and Metabolically Stable Inhibitor of Receptor-Interacting Protein 1 (RIP1) for the Treatment of Systemic Inflammatory Response Syndrome. J Med Chem60:972-986 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Receptor-interacting protein 1 (RIPK1)
Name:Receptor-interacting protein 1 (RIPK1)
Synonyms:Mitogen-activated protein kinase 10/Receptor-interacting serine/threonine-protein kinase 1 | RIP-1 | RIPK1 | Receptor-interacting protein 1 | Receptor-interacting serine/threonine-protein kinase 1
Type:Enzyme Catalytic Domain
Mol. Mass.:75926.99
Organism:Homo sapiens (Human)
Description:aa 8-327
Residue:671
Sequence:
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229509
NameBDBM50229509
Synonyms:CHEMBL4100395
TypeSmall organic molecule
Emp. Form.C13H14F3NO
Mol. Mass.257.2516
SMILESCN(Cc1cc(F)cc(F)c1F)C(=O)C1(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a