Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidyl-prolyl cis-trans isomerase A
LigandBDBM50230212
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1644715
Ki 7.0±n/a nM
Citation Steadman, VAPettit, SBPoullennec, KGLazarides, LKeats, AJDean, DKStanway, SJAustin, CASanvoisin, JAWatt, GMFliri, HGLiclican, ACJin, DWong, MHLeavitt, SALee, YJTian, YFrey, CRAppleby, TCSchmitz, UJansa, PMackman, RLSchultz, BE Discovery of Potent Cyclophilin Inhibitors Based on the Structural Simplification of Sanglifehrin A. J Med Chem60:1000-1017 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptidyl-prolyl cis-trans isomerase A
Name:Peptidyl-prolyl cis-trans isomerase A
Synonyms:CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIase A | Rotamase A
Type:Protein
Mol. Mass.:18015.32
Organism:Homo sapiens (Human)
Description:P62937
Residue:165
Sequence:
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50230212
NameBDBM50230212
Synonyms:CHEMBL4084776
TypeSmall organic molecule
Emp. Form.C30H44N4O6
Mol. Mass.556.6936
SMILESCO[C@@H]1CC\C=C\c2cccc(c2)[C@@H](C)OC(=O)[C@@H]2CCCN(N2)C(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H]1C)C(C)C |r,t:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a